Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCG5 Peptide - N-terminal region

SCG5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

7B2, P7B2, SGNE1, SgV

UniProt

P05408

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCG5 Rabbit Polyclonal Antibody (orb585788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138229

Preservative

Lyophilized powder

AA Sequence

GPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGCG (Gamma-Sarcoglycan, Sarcoglycan, Gamma (35kD Dystrophin-associated Glycoprotein) )
491586 100 µL

SGCG (Gamma-Sarcoglycan, Sarcoglycan, Gamma (35kD Dystrophin-associated Glycoprotein) )

Sign In for Pricing
View Details
OASA02297-100T - CD59 Antibody - PE Conjugated
OASA02297-100T 100 Tests

OASA02297-100T - CD59 Antibody - PE Conjugated

Sign In for Pricing
View Details
PAPP-A HDR Plasmid (h2)
sc-406222-HDR-2 20 µg

PAPP-A HDR Plasmid (h2)

Sign In for Pricing
View Details
N1- (2-Aminophenyl) -N7-Phenylheptanediamide
OR1025640-01 100 mg

N1- (2-Aminophenyl) -N7-Phenylheptanediamide

Sign In for Pricing
View Details
N1- (2-Aminophenyl) -N7-Phenylheptanediamide
OR1025640-02 250 mg

N1- (2-Aminophenyl) -N7-Phenylheptanediamide

Sign In for Pricing
View Details
N1- (2-Aminophenyl) -N7-Phenylheptanediamide
OR1025640-03 1 g

N1- (2-Aminophenyl) -N7-Phenylheptanediamide

Sign In for Pricing
View Details