Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAP2A Peptide - C-terminal region

RAP2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

K-REV, KREV, RAP2, RbBP-30

UniProt

P10114

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAP2A Rabbit Polyclonal Antibody (orb585843) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066361

Preservative

Lyophilized powder

AA Sequence

QIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSAD Antibody, Biotin conjugated
A18244-50UG 50 µg

CSAD Antibody, Biotin conjugated

Sign In for Pricing
View Details
α-Conotoxin EI
B5380-.5 500 µg

α-Conotoxin EI

Sign In for Pricing
View Details
ACSBG1 Rabbit Polyclonal Antibody
orb331110 100 µL

ACSBG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vom2r23 ORF Vector (Rat) (pORF)
ORF078930 1.0 µg DNA

Vom2r23 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Human PNLIP Protein, N-His
orb2962703-01 50 µg

Recombinant Human PNLIP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PNLIP Protein, N-His
orb2962703-02 100 µg

Recombinant Human PNLIP Protein, N-His

Sign In for Pricing
View Details