Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAP2A Peptide - C-terminal region

RAP2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

K-REV, KREV, RAP2, RbBP-30

UniProt

P10114

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAP2A Rabbit Polyclonal Antibody (orb585843) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066361

Preservative

Lyophilized powder

AA Sequence

QIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNL1 Polyclonal Antibody, FITC Conjugated
A54980-100 100 µL

TXNL1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
CROT Rabbit pAb
E47R5048 100 µL

CROT Rabbit pAb

Sign In for Pricing
View Details
Magic™ Antibody Discovery - Mouse M-CSF R / CSF1R / CD115 (20-511) Membrane Protein, PaRoom Temperatureial, -hIgG1 Fc tag
MP0672F Each

Magic™ Antibody Discovery - Mouse M-CSF R / CSF1R / CD115 (20-511) Membrane Protein, PaRoom Temperatureial, -hIgG1 Fc tag

Sign In for Pricing
View Details
ExoStd? Lyophilized Exosome Standard (100 µg, BLCL21 cell line, 6 vials)
M1053-6 each

ExoStd? Lyophilized Exosome Standard (100 µg, BLCL21 cell line, 6 vials)

Sign In for Pricing
View Details
Rac 2 Lentiviral Activation Particles (m2)
sc-422574-LAC-2 200 µL

Rac 2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
C87414 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4195702 1.0 µg DNA

C87414 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details