Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAP2A Peptide - N-terminal region

RAP2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

K-REV, KREV, RAP2, RbBP-30

UniProt

P10114

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAP2A Rabbit Polyclonal Antibody (orb585844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066361

Preservative

Lyophilized powder

AA Sequence

KYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BeaverBeads™ Magrose NHS
70702-1 1 mL - 20% (v/v) - (30-150) μm

BeaverBeads™ Magrose NHS

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Non-canonical purine NTP phosphatase (yjjX)
MBS1149252-01 0.02 mg (E-Coli)

Recombinant Salmonella gallinarum Non-canonical purine NTP phosphatase (yjjX)

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Non-canonical purine NTP phosphatase (yjjX)
MBS1149252-02 0.1 mg (E-Coli)

Recombinant Salmonella gallinarum Non-canonical purine NTP phosphatase (yjjX)

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Non-canonical purine NTP phosphatase (yjjX)
MBS1149252-03 0.02 mg (Yeast)

Recombinant Salmonella gallinarum Non-canonical purine NTP phosphatase (yjjX)

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Non-canonical purine NTP phosphatase (yjjX)
MBS1149252-04 0.1 mg (Yeast)

Recombinant Salmonella gallinarum Non-canonical purine NTP phosphatase (yjjX)

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Non-canonical purine NTP phosphatase (yjjX)
MBS1149252-05 0.02 mg (Baculovirus)

Recombinant Salmonella gallinarum Non-canonical purine NTP phosphatase (yjjX)

Sign In for Pricing
View Details