Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAP2A Peptide - N-terminal region

RAP2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

K-REV, KREV, RAP2, RbBP-30

UniProt

P10114

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAP2A Rabbit Polyclonal Antibody (orb585844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066361

Preservative

Lyophilized powder

AA Sequence

KYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ERVV-2 sgRNA gene knockout kit - Lentiviral human ERVV-2 sgRNA gene knockout kit (plasmid)
GTR15388628 1 Vial

Lentiviral human ERVV-2 sgRNA gene knockout kit - Lentiviral human ERVV-2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
HTRA3 (HtrA Serine Peptidase 3, Prsp, Tasp)
247336 100 µg

HTRA3 (HtrA Serine Peptidase 3, Prsp, Tasp)

Sign In for Pricing
View Details
Guinea pig procollagen III propeptide (PIIIP) ELISA Kit
EIA07712Gu 1 Kit

Guinea pig procollagen III propeptide (PIIIP) ELISA Kit

Sign In for Pricing
View Details
ICAM5 (Intercellular Adhesion Molecule 5, TLN, TLCN) discontinued
211405-01 20 µL

ICAM5 (Intercellular Adhesion Molecule 5, TLN, TLCN) discontinued

Sign In for Pricing
View Details
ICAM5 (Intercellular Adhesion Molecule 5, TLN, TLCN) discontinued
211405-02 100 µL

ICAM5 (Intercellular Adhesion Molecule 5, TLN, TLCN) discontinued

Sign In for Pricing
View Details
MSPR/RON/CD136 (narnatumab) discontinued
047766 100 µg

MSPR/RON/CD136 (narnatumab) discontinued

Sign In for Pricing
View Details