Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFTPA2 Peptide - N-terminal region

SFTPA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

COLEC5, FLJ50594, FLJ50597, FLJ51953, FLJ79091, FLJ93678, MGC133169, MGC133366, MGC189714, MGC189761, PSAP, SFTP1, SFTPA2B, SPA2, SPAII

UniProt

Q8IWL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFTPA2 Rabbit Polyclonal Antibody (orb326486) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001092138

Preservative

Lyophilized powder

AA Sequence

PGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Protein Kinase C Delta Type (PKCδ) ELISA Kit
JL43546-01 48 Tests

Mouse Protein Kinase C Delta Type (PKCδ) ELISA Kit

Sign In for Pricing
View Details
Mouse Protein Kinase C Delta Type (PKCδ) ELISA Kit
JL43546-02 96 Tests

Mouse Protein Kinase C Delta Type (PKCδ) ELISA Kit

Sign In for Pricing
View Details
PDGFC Antibody (N-term) Blocking Peptide
MBS9222392-01 0.5 mg

PDGFC Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
PDGFC Antibody (N-term) Blocking Peptide
MBS9222392-02 5x 0.5 mg

PDGFC Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
Mouse Pcdhb10 activation kit by CRISPRa
GA211374 1 Kit

Mouse Pcdhb10 activation kit by CRISPRa

Sign In for Pricing
View Details
MTNR1B Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-21511R-APC-Cy5.5 100 µL

MTNR1B Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details