Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFTPA2 Peptide - N-terminal region

SFTPA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

COLEC5, FLJ50594, FLJ50597, FLJ51953, FLJ79091, FLJ93678, MGC133169, MGC133366, MGC189714, MGC189761, PSAP, SFTP1, SFTPA2B, SPA2, SPAII

UniProt

Q8IWL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFTPA2 Rabbit Polyclonal Antibody (orb326486) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001092138

Preservative

Lyophilized powder

AA Sequence

PGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Actin Alpha 1 Skeletal Muscle Antibody (3B3) [Alexa Fluor 750]
NBP1-97723AF750 0.1 mL

Mouse Monoclonal Actin Alpha 1 Skeletal Muscle Antibody (3B3) [Alexa Fluor 750]

Sign In for Pricing
View Details
Liposomal NMN
HY-177843 1 Each

Liposomal NMN

Sign In for Pricing
View Details
Recombinant Tamias bulleri Cytochrome c oxidase subunit 2 (MT-CO2), partial
MBS7090492 Inquire

Recombinant Tamias bulleri Cytochrome c oxidase subunit 2 (MT-CO2), partial

Sign In for Pricing
View Details
GMIP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
22281066 1.0 µg DNA

GMIP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit anti-Mus musculus (Mouse) RAD52 Polyclonal Antibody
MBS7141521 Inquire

Rabbit anti-Mus musculus (Mouse) RAD52 Polyclonal Antibody

Sign In for Pricing
View Details
4- (Difluoromethyl) pyridin-2-ol
PC1003413-01 100 mg

4- (Difluoromethyl) pyridin-2-ol

Sign In for Pricing
View Details