Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX1 Peptide - N-terminal region

SNX1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HsT17379, MGC8664, SNX1A, Vps5, VPS5

UniProt

Q13596

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX1 Rabbit Polyclonal Antibody (orb331258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001229862

Preservative

Lyophilized powder

AA Sequence

EDIFTGAAVVSKHQSPKITTSLLPINNGSKENGIHEEQDQEPQDLFADAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASGRP 4 (RASGRP4) (NM_001146205) Human Over-expression Lysate
LC431540 20 µg

RASGRP 4 (RASGRP4) (NM_001146205) Human Over-expression Lysate

Sign In for Pricing
View Details
PE Anti-Mouse CD115/CSF-1R Antibody[AFS98]
E-AB-F1107D-01 50 Tests

PE Anti-Mouse CD115/CSF-1R Antibody[AFS98]

Sign In for Pricing
View Details
PE Anti-Mouse CD115/CSF-1R Antibody[AFS98]
E-AB-F1107D-02 100 Tests

PE Anti-Mouse CD115/CSF-1R Antibody[AFS98]

Sign In for Pricing
View Details
PE Anti-Mouse CD115/CSF-1R Antibody[AFS98]
E-AB-F1107D-03 2x 100 Tests

PE Anti-Mouse CD115/CSF-1R Antibody[AFS98]

Sign In for Pricing
View Details
Tissue Total RNA, Stomach
CR560250 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details
4-Amino-2,6-dichloro-a-(4-chlorophenyl)benzeneacetonitrile
TRC-A604655-1G 1 g

4-Amino-2,6-dichloro-a-(4-chlorophenyl)benzeneacetonitrile

Sign In for Pricing
View Details