Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOS1AP Peptide - C-terminal region

NOS1AP Peptide - C-terminal region

Product Specifications

Product Name Alternative

6330408P19Rik, CAPON

UniProt

O75052

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOS1AP Rabbit Polyclonal Antibody (orb585850) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

BAA32309

Preservative

Lyophilized powder

AA Sequence

PEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWSQEELP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YAP1 Antibody, Biotin conjugated
A77237-50UL 50 μL

YAP1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
PEX11B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
36404066 1.0 µg DNA

PEX11B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
WSTF Rabbit mAb
59763 50 µL

WSTF Rabbit mAb

Sign In for Pricing
View Details
PAFAH1B2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
35935154 3x 1.0 µg DNA

PAFAH1B2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
FITC Syrian Hamster IgG Isotype Control
MBS4514295-01 0.025 mg

FITC Syrian Hamster IgG Isotype Control

Sign In for Pricing
View Details
FITC Syrian Hamster IgG Isotype Control
MBS4514295-02 0.05 mg

FITC Syrian Hamster IgG Isotype Control

Sign In for Pricing
View Details