Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOS1AP Peptide - C-terminal region

NOS1AP Peptide - C-terminal region

Product Specifications

Product Name Alternative

6330408P19Rik, CAPON

UniProt

O75052

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOS1AP Rabbit Polyclonal Antibody (orb585850) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

BAA32309

Preservative

Lyophilized powder

AA Sequence

PEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWSQEELP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyldopa anhydrous
orb1740375-01 25 mg

Methyldopa anhydrous

Sign In for Pricing
View Details
Methyldopa anhydrous
orb1740375-02 50 mg

Methyldopa anhydrous

Sign In for Pricing
View Details
Methyldopa anhydrous
orb1740375-03 100 mg

Methyldopa anhydrous

Sign In for Pricing
View Details
FAHD2A Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-8228R-BF647 100 µL

FAHD2A Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
DSCAML1 siRNA (Human)
orb1856811-01 15 nmol

DSCAML1 siRNA (Human)

Sign In for Pricing
View Details
DSCAML1 siRNA (Human)
orb1856811-02 30 nmol

DSCAML1 siRNA (Human)

Sign In for Pricing
View Details