Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB1B Peptide - C-terminal region

RAB1B Peptide - C-terminal region

Product Specifications

UniProt

Q9H0U4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB1B Rabbit Polyclonal Antibody (orb585862) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112243

Preservative

Lyophilized powder

AA Sequence

TSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANGPT2 Antibody
orb689098-01 50 μL

ANGPT2 Antibody

Sign In for Pricing
View Details
ANGPT2 Antibody
orb689098-02 100 µL

ANGPT2 Antibody

Sign In for Pricing
View Details
PKC delta Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2428384 100 µL

PKC delta Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Research Grade efmirenpase alfa Antibody
orb3151286-01 100 µg

Research Grade efmirenpase alfa Antibody

Sign In for Pricing
View Details
Research Grade efmirenpase alfa Antibody
orb3151286-02 1 mg

Research Grade efmirenpase alfa Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Bromodeoxyuridine/BrdU Antibody (SPM537) [mFluor Violet 610 SE]
NBP2-34784MFV610 0.1 mL

Mouse Monoclonal Bromodeoxyuridine/BrdU Antibody (SPM537) [mFluor Violet 610 SE]

Sign In for Pricing
View Details