Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB1B Peptide - C-terminal region

RAB1B Peptide - C-terminal region

Product Specifications

UniProt

Q9H0U4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB1B Rabbit Polyclonal Antibody (orb585862) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112243

Preservative

Lyophilized powder

AA Sequence

TSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyp4f17 3'UTR Luciferase Stable Cell Line
TU104715 1.0 mL

Cyp4f17 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Alpha-Tocopherol Transfer Protein (TTPa)
MBS2079037-01 0.1 mL

FITC-Linked Polyclonal Antibody to Alpha-Tocopherol Transfer Protein (TTPa)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Alpha-Tocopherol Transfer Protein (TTPa)
MBS2079037-02 0.2 mL

FITC-Linked Polyclonal Antibody to Alpha-Tocopherol Transfer Protein (TTPa)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Alpha-Tocopherol Transfer Protein (TTPa)
MBS2079037-03 0.5 mL

FITC-Linked Polyclonal Antibody to Alpha-Tocopherol Transfer Protein (TTPa)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Alpha-Tocopherol Transfer Protein (TTPa)
MBS2079037-04 1 mL

FITC-Linked Polyclonal Antibody to Alpha-Tocopherol Transfer Protein (TTPa)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Alpha-Tocopherol Transfer Protein (TTPa)
MBS2079037-05 5 mL

FITC-Linked Polyclonal Antibody to Alpha-Tocopherol Transfer Protein (TTPa)

Sign In for Pricing
View Details