Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX13 Peptide - C-terminal region

PEX13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NALD, ZWS

UniProt

Q92968

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PEX13 Rabbit Polyclonal Antibody (orb585865) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002609

Preservative

Lyophilized powder

AA Sequence

SFTNPTLTKGATVADSLDEQEAAFESVFVETNKVPVAPDSIGKDGEKQDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Anti-C4 Binding Protein Alpha (C4BPA)
FY-AB43554-01 1 mL

FITC-Linked Anti-C4 Binding Protein Alpha (C4BPA)

Sign In for Pricing
View Details
FITC-Linked Anti-C4 Binding Protein Alpha (C4BPA)
FY-AB43554-02 100 µL

FITC-Linked Anti-C4 Binding Protein Alpha (C4BPA)

Sign In for Pricing
View Details
FITC-Linked Anti-C4 Binding Protein Alpha (C4BPA)
FY-AB43554-03 200 µL

FITC-Linked Anti-C4 Binding Protein Alpha (C4BPA)

Sign In for Pricing
View Details
Human IgM Antibody (YA1062, Mouse)
HY-P81317-01 10 µL

Human IgM Antibody (YA1062, Mouse)

Sign In for Pricing
View Details
Human IgM Antibody (YA1062, Mouse)
HY-P81317-02 50 μL

Human IgM Antibody (YA1062, Mouse)

Sign In for Pricing
View Details
Human IgM Antibody (YA1062, Mouse)
HY-P81317-03 100 µL

Human IgM Antibody (YA1062, Mouse)

Sign In for Pricing
View Details