Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX13 Peptide - C-terminal region

PEX13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NALD, ZWS

UniProt

Q92968

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PEX13 Rabbit Polyclonal Antibody (orb585865) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002609

Preservative

Lyophilized powder

AA Sequence

SFTNPTLTKGATVADSLDEQEAAFESVFVETNKVPVAPDSIGKDGEKQDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-conjugated Anti-Nectin-4 (enfortumab biosimilar) mAb
MBS1880559-01 100 Tests

PE-conjugated Anti-Nectin-4 (enfortumab biosimilar) mAb

Sign In for Pricing
View Details
PE-conjugated Anti-Nectin-4 (enfortumab biosimilar) mAb
MBS1880559-02 5x 100 Tests

PE-conjugated Anti-Nectin-4 (enfortumab biosimilar) mAb

Sign In for Pricing
View Details
BAAT Polyclonal Antibody
JOT-AP06643-01 20 µL

BAAT Polyclonal Antibody

Sign In for Pricing
View Details
BAAT Polyclonal Antibody
JOT-AP06643-02 50 μL

BAAT Polyclonal Antibody

Sign In for Pricing
View Details
BAAT Polyclonal Antibody
JOT-AP06643-03 100 µL

BAAT Polyclonal Antibody

Sign In for Pricing
View Details
4-Nitrophenol AR (p-Nitro Phenol Indicator AR
1141090 25 25 g

4-Nitrophenol AR (p-Nitro Phenol Indicator AR

Sign In for Pricing
View Details