Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYOT Peptide - C-terminal region

MYOT Peptide - C-terminal region

Product Specifications

Product Name Alternative

LGMD1, LGMD1A, TTID

UniProt

Q9UBF9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYOT Rabbit Polyclonal Antibody (orb585868) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006781

Preservative

Lyophilized powder

AA Sequence

RNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKIP (INPP5K) (NM_001135642) Human Over-expression Lysate
LC427643 20 µg

SKIP (INPP5K) (NM_001135642) Human Over-expression Lysate

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF594 conjugate, 0.1mg/mL
BNC942338-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Vitamin D-Binding Protein Antibody
RC-6010-01 50 μL

Recombinant Vitamin D-Binding Protein Antibody

Sign In for Pricing
View Details
Recombinant Vitamin D-Binding Protein Antibody
RC-6010-02 100 µL

Recombinant Vitamin D-Binding Protein Antibody

Sign In for Pricing
View Details
Recombinant Vitamin D-Binding Protein Antibody
RC-6010-03 1 mL

Recombinant Vitamin D-Binding Protein Antibody

Sign In for Pricing
View Details
LRCH4 (NM_002319) Human Over-expression Lysate
LC419382 20 µg

LRCH4 (NM_002319) Human Over-expression Lysate

Sign In for Pricing
View Details