Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTCP1NB Peptide - N-terminal region

MTCP1NB Peptide - N-terminal region

Product Specifications

Product Name Alternative

C6.1B, MGC2069, MTCP1, p8, p8MTCP1, MTCP1NB

UniProt

P56277

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTCP1NB Rabbit Polyclonal Antibody (orb324369) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001018024

Preservative

Lyophilized powder

AA Sequence

KCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-100 1x 100 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-100 1x 100 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 6 (MUC6) (MUC6/916), CF405S conjugate, 0.1mg/mL
BNC040916-500 1x 500 µL

Mucin 6 (MUC6) (MUC6/916), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF405M conjugate, 0.1mg/mL
BNC050485-500 1x 500 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD33 (C33/69), CF594 conjugate, 0.1mg/mL
BNC940069-500 1x 500 µL

CD33 (C33/69), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details