Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMUB2 Peptide - C-terminal region

TMUB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FP2653, MGC3123

UniProt

Q71RG4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMUB2 Rabbit Polyclonal Antibody (orb579354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_803190

Preservative

Lyophilized powder

AA Sequence

PPGSAVPGPSASLAPSATEPPSLGVNVGSLMVPVFVVLLGVVWYFRINYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2X1 (P2RX1) (NM_002558) Human Tagged Lenti ORF Clone
RC207924L4 10 µg

P2X1 (P2RX1) (NM_002558) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RPUSD2 Recombinant Protein (Human)
RP027250 100 µg

RPUSD2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Recombinant Caenorhabditis briggsae Probable DNA-directed RNA polymerase II subunit RPB11 (rpb-11)
MBS1298212-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis briggsae Probable DNA-directed RNA polymerase II subunit RPB11 (rpb-11)

Sign In for Pricing
View Details
Recombinant Caenorhabditis briggsae Probable DNA-directed RNA polymerase II subunit RPB11 (rpb-11)
MBS1298212-02 0.1 mg (E-Coli)

Recombinant Caenorhabditis briggsae Probable DNA-directed RNA polymerase II subunit RPB11 (rpb-11)

Sign In for Pricing
View Details
Recombinant Caenorhabditis briggsae Probable DNA-directed RNA polymerase II subunit RPB11 (rpb-11)
MBS1298212-03 0.02 mg (Yeast)

Recombinant Caenorhabditis briggsae Probable DNA-directed RNA polymerase II subunit RPB11 (rpb-11)

Sign In for Pricing
View Details
Recombinant Caenorhabditis briggsae Probable DNA-directed RNA polymerase II subunit RPB11 (rpb-11)
MBS1298212-04 0.1 mg (Yeast)

Recombinant Caenorhabditis briggsae Probable DNA-directed RNA polymerase II subunit RPB11 (rpb-11)

Sign In for Pricing
View Details