Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMUB2 Peptide - C-terminal region

TMUB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FP2653, MGC3123

UniProt

Q71RG4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMUB2 Rabbit Polyclonal Antibody (orb579354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_803190

Preservative

Lyophilized powder

AA Sequence

PPGSAVPGPSASLAPSATEPPSLGVNVGSLMVPVFVVLLGVVWYFRINYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS15 (NM_139055) Human Over-expression Lysate
LS170689 100 µg

ADAMTS15 (NM_139055) Human Over-expression Lysate

Sign In for Pricing
View Details
WSB1 Protein Vector (Mouse) (pPB-N-His)
PV247651 500 ng

WSB1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
PKC Recombinant Antibody, PE-Cy7 Conjugated
bsm-62958R-PE-Cy7-01 20 µL

PKC Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
PKC Recombinant Antibody, PE-Cy7 Conjugated
bsm-62958R-PE-Cy7-02 100 µL

PKC Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Genipin
300322 20 mg

Genipin

Sign In for Pricing
View Details
Calprotectin, Human, ELISA kit
HK379-02 2x 96 Determinations

Calprotectin, Human, ELISA kit

Sign In for Pricing
View Details