Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLIG1 Peptide - N-terminal region

OLIG1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BHLHB6, BHLHE21

UniProt

Q8TAK6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OLIG1 Rabbit Polyclonal Antibody (orb330457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620450

Preservative

Lyophilized powder

AA Sequence

MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Protein HIRA (HIRA) ELISA Kit
abx527163 96 Tests

Human Protein HIRA (HIRA) ELISA Kit

Sign In for Pricing
View Details
HRAS (HRAS1, H-Ras-1, c-H-ras, C-Ha-Ras1, Ha-Ras, GTPase HRas, C-Bas/Has, CTLO, HAMSV, H-RASIDX, K-Ras, p21ras, RASH1, Transforming Protein p21)
H8010 200 µL

HRAS (HRAS1, H-Ras-1, c-H-ras, C-Ha-Ras1, Ha-Ras, GTPase HRas, C-Bas/Has, CTLO, HAMSV, H-RASIDX, K-Ras, p21ras, RASH1, Transforming Protein p21)

Sign In for Pricing
View Details
AMPD1 siRNA (Human)
orb1868073-01 15 nmol

AMPD1 siRNA (Human)

Sign In for Pricing
View Details
AMPD1 siRNA (Human)
orb1868073-02 30 nmol

AMPD1 siRNA (Human)

Sign In for Pricing
View Details
Monoclonal Transgelin (SM22-alpha) Antibody, Clone: TAGLN/247
AMM01347G 7 ml

Monoclonal Transgelin (SM22-alpha) Antibody, Clone: TAGLN/247

Sign In for Pricing
View Details
Dcaf12 sgRNA CRISPR Lentivector set (Mouse)
K4729801 3x 1.0 µg

Dcaf12 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details