Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMD4 Peptide - N-terminal region

TIMD4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ27515, SMUCKLER, TIM4

UniProt

Q96H15

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TIMD4 Rabbit Polyclonal Antibody (orb579497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001140198

Preservative

Lyophilized powder

AA Sequence

CKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akt1 Polyclonal Antibody
E95523 100 µL

Akt1 Polyclonal Antibody

Sign In for Pricing
View Details
Tetrahydropyran-3-boronic acid pinacol ester
291382-01 25 mg

Tetrahydropyran-3-boronic acid pinacol ester

Sign In for Pricing
View Details
Tetrahydropyran-3-boronic acid pinacol ester
291382-02 50 mg

Tetrahydropyran-3-boronic acid pinacol ester

Sign In for Pricing
View Details
Tetrahydropyran-3-boronic acid pinacol ester
291382-03 100 mg

Tetrahydropyran-3-boronic acid pinacol ester

Sign In for Pricing
View Details
Tetrahydropyran-3-boronic acid pinacol ester
291382-04 250 mg

Tetrahydropyran-3-boronic acid pinacol ester

Sign In for Pricing
View Details
Tetrahydropyran-3-boronic acid pinacol ester
291382-05 500 mg

Tetrahydropyran-3-boronic acid pinacol ester

Sign In for Pricing
View Details