Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YIPF1 Peptide - C-terminal region

YIPF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DJ167A19.1, FinGER1

UniProt

Q9Y548

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YIPF1 Rabbit Polyclonal Antibody (orb580725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061855

Preservative

Lyophilized powder

AA Sequence

VALATIVTIVLLHMLLSVGCLAYFFDAPEMDHLPTTTATPNQTVAAAKSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant E Coli MUTM Protein
MBS8249472-01 0.01 mg

Recombinant E Coli MUTM Protein

Sign In for Pricing
View Details
Recombinant E Coli MUTM Protein
MBS8249472-02 0.05 mg

Recombinant E Coli MUTM Protein

Sign In for Pricing
View Details
Recombinant E Coli MUTM Protein
MBS8249472-03 0.5 mg

Recombinant E Coli MUTM Protein

Sign In for Pricing
View Details
Recombinant E Coli MUTM Protein
MBS8249472-04 5x 0.5 mg

Recombinant E Coli MUTM Protein

Sign In for Pricing
View Details
Polyclonal ELOVL7 Antibody
APR07697G 0.1 mg

Polyclonal ELOVL7 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ADP-ribosylarginine hydrolase Antibody [Janelia Fluor 635]
NBP3-20168JF635 0.1 mL

Rabbit Polyclonal ADP-ribosylarginine hydrolase Antibody [Janelia Fluor 635]

Sign In for Pricing
View Details