Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOE Peptide - N-terminal region

APOE Peptide - N-terminal region

Product Specifications

Product Name Alternative

AD2, LDLCQ5, LPG, MGC1571

UniProt

P02649

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOE Rabbit Polyclonal Antibody (orb333723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_000032

Preservative

Lyophilized powder

AA Sequence

LMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptophysin (Neuroendocrine Marker) (SYP/3551), CF740 conjugate, 0.1mg/mL
BNC743551-100 1x 100 µL

Synaptophysin (Neuroendocrine Marker) (SYP/3551), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD40 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F12]
TA807575AM 100 µL

CD40 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F12]

Sign In for Pricing
View Details
Human ANG1 (Angiopoietin 1) ELISA Kit
E-EL-H6119-01 24 Tests

Human ANG1 (Angiopoietin 1) ELISA Kit

Sign In for Pricing
View Details
Human ANG1 (Angiopoietin 1) ELISA Kit
E-EL-H6119-02 48 Tests

Human ANG1 (Angiopoietin 1) ELISA Kit

Sign In for Pricing
View Details
Human ANG1 (Angiopoietin 1) ELISA Kit
E-EL-H6119-03 96 Tests

Human ANG1 (Angiopoietin 1) ELISA Kit

Sign In for Pricing
View Details
UROD Goat Polyclonal Antibody
AP32135PU-N 100 µg

UROD Goat Polyclonal Antibody

Sign In for Pricing
View Details