Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF2 Peptide - C-terminal region

IGF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C11orf43, FLJ22066, FLJ44734, INSIGF, pp9974, IGF-II, PP9974

UniProt

C9JAF2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IGF2 Rabbit Polyclonal Antibody (orb582294) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121070

Preservative

Lyophilized powder

AA Sequence

YDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF beta Receptor III (TGFBR3) Mouse Monoclonal Antibody [Clone ID: LBI6B2]
AMM18945VCF 100 µg

TGF beta Receptor III (TGFBR3) Mouse Monoclonal Antibody [Clone ID: LBI6B2]

Sign In for Pricing
View Details
INCA1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1087205 3x 1.0 µg

INCA1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Monoclonal Integrin beta 1/CD29 Antibody (ITGB1/8744R) [DyLight 405]
NBP3-20709V 0.1 mL

Rabbit Monoclonal Integrin beta 1/CD29 Antibody (ITGB1/8744R) [DyLight 405]

Sign In for Pricing
View Details
ZEB2 antibody
CAF50409 100 µg

ZEB2 antibody

Sign In for Pricing
View Details
Anti-BLOC1S6 antibody
STJ25026 100 µl

Anti-BLOC1S6 antibody

Sign In for Pricing
View Details
LY 134046
T27872-01 25 mg

LY 134046

Sign In for Pricing
View Details