Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF2 Peptide - C-terminal region

IGF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C11orf43, FLJ22066, FLJ44734, INSIGF, pp9974, IGF-II, PP9974

UniProt

C9JAF2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IGF2 Rabbit Polyclonal Antibody (orb582294) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121070

Preservative

Lyophilized powder

AA Sequence

YDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NATtrol Influenza/RSV Negative Control (6 X 0.5 mL)
MDZ045 6x 0.5 mL

NATtrol Influenza/RSV Negative Control (6 X 0.5 mL)

Sign In for Pricing
View Details
ADAMDEC1 Peptide - middle region (AAP55070)
AAP55070-100UG 100 µg

ADAMDEC1 Peptide - middle region (AAP55070)

Sign In for Pricing
View Details
Mouse Ebpl activation kit by CRISPRa
GA207711 1 Kit

Mouse Ebpl activation kit by CRISPRa

Sign In for Pricing
View Details
GATA-5 Recombinant Protein Antigen
NBP2-56593PEP 100 µL

GATA-5 Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant Microtubule Associated Protein 2 (MAP2)
RPU56943-01 50 µg

Recombinant Microtubule Associated Protein 2 (MAP2)

Sign In for Pricing
View Details
Recombinant Microtubule Associated Protein 2 (MAP2)
RPU56943-02 100 µg

Recombinant Microtubule Associated Protein 2 (MAP2)

Sign In for Pricing
View Details