NPAL3 Peptide - N-terminal region
NPAL3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DJ462O23.2, DKFZp686E22155, NPAL3, RP3-462O23.3
UniProt
Q6P499
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NPAL3 Rabbit Polyclonal Antibody (orb580764) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065181
Preservative
Lyophilized powder
AA Sequence
MDGSHSAALKLQQLPPTSSSSAVSEASFSYKENLIGALLAIFGHLVVSIA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402216-100 1x 100 µL
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details