Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TP73-AS1 Peptide - C-terminal region

TP73-AS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC138189

UniProt

Q9UF72

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_997189

Preservative

Lyophilized powder

AA Sequence

VVDENSCCLLYVVEDQLCDVEQAFRAEHLGQHQSGSGTGCRHCPQRPAAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p-Ethylhydratropic Acid
TRC-E918820-250MG 250 mg

p-Ethylhydratropic Acid

Sign In for Pricing
View Details
Shisa6 Mouse Gene Knockout Kit (CRISPR)
KN515754 1 Kit

Shisa6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rab11a Mouse Gene Knockout Kit (CRISPR)
KN514324 1 Kit

Rab11a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IL-8 (Interleukin 8) CLIA Kit
E-CL-H0048-01 24 Tests

Human IL-8 (Interleukin 8) CLIA Kit

Sign In for Pricing
View Details
Human IL-8 (Interleukin 8) CLIA Kit
E-CL-H0048-02 48 Tests

Human IL-8 (Interleukin 8) CLIA Kit

Sign In for Pricing
View Details
Human IL-8 (Interleukin 8) CLIA Kit
E-CL-H0048-03 96 Tests

Human IL-8 (Interleukin 8) CLIA Kit

Sign In for Pricing
View Details