Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL5RA Peptide - N-terminal region

IL5RA Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD125, CDw125, HSIL5R3, IL5R, MGC26560

UniProt

Q01344

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL5RA Rabbit Polyclonal Antibody (orb585698) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783853

Preservative

Lyophilized powder

AA Sequence

GLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament Medium Antibody
OC-462-01 50 μL

Neurofilament Medium Antibody

Sign In for Pricing
View Details
Neurofilament Medium Antibody
OC-462-02 100 µL

Neurofilament Medium Antibody

Sign In for Pricing
View Details
Neurofilament Medium Antibody
OC-462-03 1 mL

Neurofilament Medium Antibody

Sign In for Pricing
View Details
NACC1 Antibody
KC-3093-01 50 μL

NACC1 Antibody

Sign In for Pricing
View Details
NACC1 Antibody
KC-3093-02 100 µL

NACC1 Antibody

Sign In for Pricing
View Details
NACC1 Antibody
KC-3093-03 1 mL

NACC1 Antibody

Sign In for Pricing
View Details