Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DRD1 Peptide - N-terminal region

DRD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DADR, DRD1A

UniProt

P21728

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DRD1 Rabbit Polyclonal Antibody (orb585711) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000785

Preservative

Lyophilized powder

AA Sequence

AAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDS

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZEB1/NIL2A Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-4187R-BF680-01 20 µL

ZEB1/NIL2A Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
ZEB1/NIL2A Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-4187R-BF680-02 100 µL

ZEB1/NIL2A Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Rabbit anti-PHAP1 Antibody
MBS4510186-01 0.05 mL

Rabbit anti-PHAP1 Antibody

Sign In for Pricing
View Details
Rabbit anti-PHAP1 Antibody
MBS4510186-02 0.1 mL

Rabbit anti-PHAP1 Antibody

Sign In for Pricing
View Details
Rabbit anti-PHAP1 Antibody
MBS4510186-03 5x 0.1 mL

Rabbit anti-PHAP1 Antibody

Sign In for Pricing
View Details
EBAG9 (NM_004215) Human Over-expression Lysate
LH07097V 100 µg

EBAG9 (NM_004215) Human Over-expression Lysate

Sign In for Pricing
View Details