Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DRD1 Peptide - N-terminal region

DRD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DADR, DRD1A

UniProt

P21728

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DRD1 Rabbit Polyclonal Antibody (orb585711) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000785

Preservative

Lyophilized powder

AA Sequence

AAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDS

More Discoveries

Explore Other Products

Browse additional items from our catalog

P38 Recombinant Rabbit mAb
orb2326761-01 25 µL

P38 Recombinant Rabbit mAb

Sign In for Pricing
View Details
P38 Recombinant Rabbit mAb
orb2326761-02 50 µL

P38 Recombinant Rabbit mAb

Sign In for Pricing
View Details
P38 Recombinant Rabbit mAb
orb2326761-03 100 µL

P38 Recombinant Rabbit mAb

Sign In for Pricing
View Details
ELISA kit for Human TEP1 (Telomerase Associated Protein 1)
E-EL-H1111 96 Tests

ELISA kit for Human TEP1 (Telomerase Associated Protein 1)

Sign In for Pricing
View Details
Chicken Polyclonal Secretagogin Antibody [PE]
NBP3-05545PE 0.1 mL

Chicken Polyclonal Secretagogin Antibody [PE]

Sign In for Pricing
View Details
IkappaB-alpha Antibody
MBS9407210-01 0.05 mL

IkappaB-alpha Antibody

Sign In for Pricing
View Details