ARMCX5 Peptide - C-terminal region
ARMCX5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DKFZp686A22185, FLJ12969, FLJ13382
UniProt
Q6P1M9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARMCX5 Rabbit Polyclonal Antibody (orb585545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_073749
Preservative
Lyophilized powder
AA Sequence
VNNPNVKEHPGALSMVDDSSESSEEPKSGESYIHQVCKGIISCPLNSPVQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041239-500 1x 500 µL
Napsin-A (NAPSA/1239), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940197-500 1x 500 µL
FOXP3 (FXP3/197), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682302-100 1x 100 µL
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details