Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMCX5 Peptide - C-terminal region

ARMCX5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686A22185, FLJ12969, FLJ13382

UniProt

Q6P1M9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARMCX5 Rabbit Polyclonal Antibody (orb585545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073749

Preservative

Lyophilized powder

AA Sequence

VNNPNVKEHPGALSMVDDSSESSEEPKSGESYIHQVCKGIISCPLNSPVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mogamulizumab Biosimilar - Research Grade
ICH5186-20mg 20 mg

Mogamulizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Becn1 Mouse Gene Knockout Kit (CRISPR)
KN502131 1 Kit

Becn1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Amino-4-thiazoleacetic Acid-13C,15N2
TRC-A630486-25MG 25 mg

2-Amino-4-thiazoleacetic Acid-13C,15N2

Sign In for Pricing
View Details
Zfp219 (ZNF219) (NM_001101672) Human Over-expression Lysate
LY420325 100 µg

Zfp219 (ZNF219) (NM_001101672) Human Over-expression Lysate

Sign In for Pricing
View Details
CD37 Human Recombinant Protein
TP723991 100 µg

CD37 Human Recombinant Protein

Sign In for Pricing
View Details
Metiprenaline
TRC-M338645-50MG 50 mg

Metiprenaline

Sign In for Pricing
View Details