Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEIL1 Peptide - C-terminal region

NEIL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ22402, FPG1, NEI1, hFPG1

UniProt

Q96FI4

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NEIL1 Rabbit Polyclonal Antibody (orb585785) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078884

Preservative

Lyophilized powder

AA Sequence

SLQDRHGRTIWFQGDPGPLAPKGRKSRKKKSKATQLSPEDRVEDALPPSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Asprv1 shRNA (UAS) - Lentiviral mouse Asprv1 shRNA (UAS, RFP) plasmid
GTR15196129 1 Vial

Lentiviral mouse Asprv1 shRNA (UAS) - Lentiviral mouse Asprv1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal PAG1 Antibody (MEM-255) [PE/Cy7]
NB500-342PECY7 0.1 mL

Mouse Monoclonal PAG1 Antibody (MEM-255) [PE/Cy7]

Sign In for Pricing
View Details
Monoclonal KIRREL2 Antibody (monoclonal) (M01), Clone: 2B9-1D3
AMM03712G 0.1mg

Monoclonal KIRREL2 Antibody (monoclonal) (M01), Clone: 2B9-1D3

Sign In for Pricing
View Details
E Cadherin (CDH1) Rabbit Polyclonal Antibody
TA321651 100 µL

E Cadherin (CDH1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACTG1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV687762 1.0 µg DNA

ACTG1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Easypro Human Survivin Antibody (Surv-Ab) ELISA Kit
FY-EH1242S 96 Well

Easypro Human Survivin Antibody (Surv-Ab) ELISA Kit

Sign In for Pricing
View Details