Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS2 Peptide - N-terminal region

KIR2DS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CU464060.1, 183ActI, CD158J, CD158b, NKAT5, cl-49

UniProt

D0UWM7

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIR2DS2 Rabbit Polyclonal Antibody (orb585800) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036444

Preservative

Lyophilized powder

AA Sequence

ETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibitor mmu-miR-1943-5p AAV miRNA Vector
Amm3025600 500 ng

Inhibitor mmu-miR-1943-5p AAV miRNA Vector

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD45 Antibody[30-F11]
E-AB-F1136UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Mouse CD45 Antibody[30-F11]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD45 Antibody[30-F11]
E-AB-F1136UQ-02 100 µg

Elab Fluor® Violet 450 Anti-Mouse CD45 Antibody[30-F11]

Sign In for Pricing
View Details
ABCA12 Polyclonal Antibody
A69003-050 50 μL

ABCA12 Polyclonal Antibody

Sign In for Pricing
View Details
2-Chloro-4-phenyl-1,3-thiazole-5-sulfonyl chloride
NKD15910-01 50 mg

2-Chloro-4-phenyl-1,3-thiazole-5-sulfonyl chloride

Sign In for Pricing
View Details
2-Chloro-4-phenyl-1,3-thiazole-5-sulfonyl chloride
NKD15910-02 0.5 g

2-Chloro-4-phenyl-1,3-thiazole-5-sulfonyl chloride

Sign In for Pricing
View Details