KIR2DS2 Peptide - N-terminal region
KIR2DS2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CU464060.1, 183ActI, CD158J, CD158b, NKAT5, cl-49
UniProt
D0UWM7
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIR2DS2 Rabbit Polyclonal Antibody (orb585800) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036444
Preservative
Lyophilized powder
AA Sequence
ETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
OR1087051-01 250 mg
N-methyl-N-phenyl-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) aniline
Sign In for Pricing
View Details OR1087051-02 500 mg
N-methyl-N-phenyl-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) aniline
Sign In for Pricing
View Details OR1087051-03 1 g
N-methyl-N-phenyl-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) aniline
Sign In for Pricing
View Details OR1087051-04 5 g
N-methyl-N-phenyl-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) aniline
Sign In for Pricing
View Details 
MBS6400088-01 0.1 mL
CLIC2 (Chloride Intracellular Channel Protein 2, XAP121, CLIC2b) (Biotin)
Sign In for Pricing
View Details MBS6400088-02 5x 0.1 mL
CLIC2 (Chloride Intracellular Channel Protein 2, XAP121, CLIC2b) (Biotin)
Sign In for Pricing
View Details