Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL19 Peptide - middle region

IL19 Peptide - middle region

Product Specifications

Product Name Alternative

IL-10C, MDA1, NG.1, ZMDA1

UniProt

Q5VUT3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL19 Rabbit Polyclonal Antibody (orb585851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_715639

Preservative

Lyophilized powder

AA Sequence

ILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (K8.8 + DC10), Biotin conjugate, 0.1mg/mL
BNCB0691-100 1x 100 µL

Cytokeratin 8/18 (K8.8 + DC10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1H,1H,2H,2H-Perfluorohexyl iodide
TRC-P286370-1G 1 g

1H,1H,2H,2H-Perfluorohexyl iodide

Sign In for Pricing
View Details
PSMA Polyclonal Antibody
D-AB-10276L-01 25 µL

PSMA Polyclonal Antibody

Sign In for Pricing
View Details
PSMA Polyclonal Antibody
D-AB-10276L-02 100 µL

PSMA Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD122/IL-2RB Protein
PKSH031478 100 µg

Recombinant Human CD122/IL-2RB Protein

Sign In for Pricing
View Details
Zinc 2-Mercaptobenzothiazole
TRC-Z701568-50G 50 g

Zinc 2-Mercaptobenzothiazole

Sign In for Pricing
View Details