Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL19 Peptide - middle region

IL19 Peptide - middle region

Product Specifications

Product Name Alternative

IL-10C, MDA1, NG.1, ZMDA1

UniProt

Q5VUT3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL19 Rabbit Polyclonal Antibody (orb585851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_715639

Preservative

Lyophilized powder

AA Sequence

ILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD127 / IL7R (Marker of T-Reg Cells) (IL7R/2751), CF640R conjugate, 0.1mg/mL
BNC402751-100 1x 100 µL

CD127 / IL7R (Marker of T-Reg Cells) (IL7R/2751), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OPN Polyclonal Antibody
AN005950L-01 25 µL

OPN Polyclonal Antibody

Sign In for Pricing
View Details
OPN Polyclonal Antibody
AN005950L-02 100 µL

OPN Polyclonal Antibody

Sign In for Pricing
View Details
CCDC19 (CFAP45) Human Gene Knockout Kit (CRISPR)
KN420922 1 Kit

CCDC19 (CFAP45) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Boc-trans-4-hydroxy-D-proline
TRC-B284940-500MG 500 mg

Boc-trans-4-hydroxy-D-proline

Sign In for Pricing
View Details
UBR1 Antibody
8C15591-AAT 50 µg

UBR1 Antibody

Sign In for Pricing
View Details