MYO10 Peptide - C-terminal region
MYO10 Peptide - C-terminal region
Product Specifications
UniProt
Q8NCI3
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MYO10 Rabbit Polyclonal Antibody (orb585900) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
BAC11158
Preservative
Lyophilized powder
AA Sequence
TYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTTRSASSQGSSR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880146-100 1x 100 µL
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470460-100 1x 100 µL
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details