Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSNAX Peptide - middle region

TSNAX Peptide - middle region

Product Specifications

Product Name Alternative

DISC1, TRAX

UniProt

Q99598

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSNAX Rabbit Polyclonal Antibody (orb585941) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005990

Preservative

Lyophilized powder

AA Sequence

QHFIKTRSLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Helicobacter Pylori rpsB Protein (aa 1-264)
VAng-Lsx3333-50gEcoli 50 µg (E. coli)

Recombinant Helicobacter Pylori rpsB Protein (aa 1-264)

Sign In for Pricing
View Details
Recombinant Tarsipes rostratus Cytochrome b (MT-CYB), partial
MBS7083878 Inquire

Recombinant Tarsipes rostratus Cytochrome b (MT-CYB), partial

Sign In for Pricing
View Details
ZDHHC4 Human qPCR Template Standard (NM_018106)
HK208068 1 Kit

ZDHHC4 Human qPCR Template Standard (NM_018106)

Sign In for Pricing
View Details
Recombinant Human Probable palmitoyltransferase ZDHHC23 (ZDHHC23)
MBS7035696-01 0.02 mg

Recombinant Human Probable palmitoyltransferase ZDHHC23 (ZDHHC23)

Sign In for Pricing
View Details
Recombinant Human Probable palmitoyltransferase ZDHHC23 (ZDHHC23)
MBS7035696-02 0.1 mg

Recombinant Human Probable palmitoyltransferase ZDHHC23 (ZDHHC23)

Sign In for Pricing
View Details
Recombinant Human Probable palmitoyltransferase ZDHHC23 (ZDHHC23)
MBS7035696-03 5x 0.1 mg

Recombinant Human Probable palmitoyltransferase ZDHHC23 (ZDHHC23)

Sign In for Pricing
View Details