Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LST1 Peptide - C-terminal region

LST1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B144, D6S49E, LST-1, MGC119006, MGC119007

UniProt

Q5SP24

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LST1 Rabbit Polyclonal Antibody (orb585908) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009092

Preservative

Lyophilized powder

AA Sequence

QAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Liver
CR561488 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
Mouse Lpcat3 activation kit by CRISPRa
GA201727 1 Kit

Mouse Lpcat3 activation kit by CRISPRa

Sign In for Pricing
View Details
CD45 / LCA (2B11), CF405S conjugate, 0.1mg/mL
BNC040470-100 1x 100 µL

CD45 / LCA (2B11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
cis-Resveratrol
TRC-R150005-5MG 5 mg

cis-Resveratrol

Sign In for Pricing
View Details
NFkB p100 / p52 Polyclonal Antibody
E-AB-65807-01 60 µL

NFkB p100 / p52 Polyclonal Antibody

Sign In for Pricing
View Details
NFkB p100 / p52 Polyclonal Antibody
E-AB-65807-02 120 µL

NFkB p100 / p52 Polyclonal Antibody

Sign In for Pricing
View Details