Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LST1 Peptide - C-terminal region

LST1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B144, D6S49E, LST-1, MGC119006, MGC119007

UniProt

Q5SP24

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LST1 Rabbit Polyclonal Antibody (orb585908) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009092

Preservative

Lyophilized powder

AA Sequence

QAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycine-1-13C
TRC-G201152-50MG 50 mg

Glycine-1-13C

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR559611 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
Human NOB1 activation kit by CRISPRa
GA109192 1 Kit

Human NOB1 activation kit by CRISPRa

Sign In for Pricing
View Details
TENT5A Rabbit Polyclonal Antibody
TA376112 100 µL

TENT5A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon
CD563127 5 µg

Tissue Genomic DNA, Colon

Sign In for Pricing
View Details
DLL1 Human Gene Knockout Kit (CRISPR)
KN222399BN 1 Kit

DLL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details