Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORMDL3 Peptide - N-terminal region

ORMDL3 Peptide - N-terminal region

Product Specifications

UniProt

Q8N138

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ORMDL3 Rabbit Polyclonal Antibody (orb585948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_644809

Preservative

Lyophilized powder

AA Sequence

GTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cathepsin S ELISA Kit
orb1659293 96 Tests

Rat Cathepsin S ELISA Kit

Sign In for Pricing
View Details
ATF4 (Phospho-Ser245) Antibody
RDSA62057 100 µL

ATF4 (Phospho-Ser245) Antibody

Sign In for Pricing
View Details
Recombinant Echinococcus granulosus Actin-1 (ACTI)
MBS1241907-01 0.02 mg (E-Coli)

Recombinant Echinococcus granulosus Actin-1 (ACTI)

Sign In for Pricing
View Details
Recombinant Echinococcus granulosus Actin-1 (ACTI)
MBS1241907-02 0.02 mg (Yeast)

Recombinant Echinococcus granulosus Actin-1 (ACTI)

Sign In for Pricing
View Details
Recombinant Echinococcus granulosus Actin-1 (ACTI)
MBS1241907-03 0.1 mg (E-Coli)

Recombinant Echinococcus granulosus Actin-1 (ACTI)

Sign In for Pricing
View Details
Recombinant Echinococcus granulosus Actin-1 (ACTI)
MBS1241907-04 0.1 mg (Yeast)

Recombinant Echinococcus granulosus Actin-1 (ACTI)

Sign In for Pricing
View Details