Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AAMP Peptide - middle region

AAMP Peptide - middle region

Product Specifications

UniProt

Q13685

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AAMP Rabbit Polyclonal Antibody (orb585951) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001078

Preservative

Lyophilized powder

AA Sequence

LKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL32 Rabbit Polyclonal Antibody (Cy7)
orb1070997 100 µL

MRPL32 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Anti-NFIB/NF1B2 Picoband antibody
MBS1750665-01 0.01 mg

Anti-NFIB/NF1B2 Picoband antibody

Sign In for Pricing
View Details
Anti-NFIB/NF1B2 Picoband antibody
MBS1750665-02 0.1 mg (Carrier Free)

Anti-NFIB/NF1B2 Picoband antibody

Sign In for Pricing
View Details
Anti-NFIB/NF1B2 Picoband antibody
MBS1750665-03 0.1 mg

Anti-NFIB/NF1B2 Picoband antibody

Sign In for Pricing
View Details
Anti-NFIB/NF1B2 Picoband antibody
MBS1750665-04 0.1 mg (Cy3)

Anti-NFIB/NF1B2 Picoband antibody

Sign In for Pricing
View Details
Anti-NFIB/NF1B2 Picoband antibody
MBS1750665-05 0.1 mg (Biotin)

Anti-NFIB/NF1B2 Picoband antibody

Sign In for Pricing
View Details