Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AAMP Peptide - middle region

AAMP Peptide - middle region

Product Specifications

UniProt

Q13685

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AAMP Rabbit Polyclonal Antibody (orb585951) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001078

Preservative

Lyophilized powder

AA Sequence

LKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuritin/NRN1 Protein (C-His, Human)
P517183 100 µg

Neuritin/NRN1 Protein (C-His, Human)

Sign In for Pricing
View Details
Innovative Grade US Origin Porcine Adult Meniscus Fresh in PBS Set of 2
IGAPCMNCP Set of 2 PCS

Innovative Grade US Origin Porcine Adult Meniscus Fresh in PBS Set of 2

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Angiopoietin Like Protein 2 (ANGPTL2)
MBS2060614-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Angiopoietin Like Protein 2 (ANGPTL2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Angiopoietin Like Protein 2 (ANGPTL2)
MBS2060614-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Angiopoietin Like Protein 2 (ANGPTL2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Angiopoietin Like Protein 2 (ANGPTL2)
MBS2060614-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Angiopoietin Like Protein 2 (ANGPTL2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Angiopoietin Like Protein 2 (ANGPTL2)
MBS2060614-04 1 mL

Cy3-Linked Polyclonal Antibody to Angiopoietin Like Protein 2 (ANGPTL2)

Sign In for Pricing
View Details