Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGL1 Peptide - C-terminal region

RGL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0959, RGL

UniProt

Q9NZL6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RGL1 Rabbit Polyclonal Antibody (orb585957) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055964

Preservative

Lyophilized powder

AA Sequence

ADASTTSPKPRKSMVKRLSLLFLGSDMITSPTPTKEQPKSTASGSSGESM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM13A Protein Vector (Mouse) (pPB-N-His)
PV177319 500 ng

FAM13A Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein, CSR, CSR1, APC7, MSLR1, MSRL1) (MaxLight 550)
MBS6213830-01 0.1 mL

SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein, CSR, CSR1, APC7, MSLR1, MSRL1) (MaxLight 550)

Sign In for Pricing
View Details
SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein, CSR, CSR1, APC7, MSLR1, MSRL1) (MaxLight 550)
MBS6213830-02 5x 0.1 mL

SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein, CSR, CSR1, APC7, MSLR1, MSRL1) (MaxLight 550)

Sign In for Pricing
View Details
Human MC2R Protein Lysate
MBS8415034-01 0.02 mg

Human MC2R Protein Lysate

Sign In for Pricing
View Details
Human MC2R Protein Lysate
MBS8415034-02 5x 0.02 mg

Human MC2R Protein Lysate

Sign In for Pricing
View Details
AZD5991 50mg
A16880-50 50 mg

AZD5991 50mg

Sign In for Pricing
View Details