Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGL1 Peptide - C-terminal region

RGL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0959, RGL

UniProt

Q9NZL6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RGL1 Rabbit Polyclonal Antibody (orb585957) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055964

Preservative

Lyophilized powder

AA Sequence

ADASTTSPKPRKSMVKRLSLLFLGSDMITSPTPTKEQPKSTASGSSGESM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPT6 3'UTR Lenti-reporter-Luc Vector
67326081 1.0 µg

SEPT6 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Pigeon SLAM Family Member 8 (SLAMF8) ELISA Kit
MBS9921740 Inquire

Pigeon SLAM Family Member 8 (SLAMF8) ELISA Kit

Sign In for Pricing
View Details
KLF10 (Kruppel-like Factor 10, EGRA, TIEG, TIEG1, EGR-alpha) (MaxLight 405)
MBS6447454-01 0.1 mL

KLF10 (Kruppel-like Factor 10, EGRA, TIEG, TIEG1, EGR-alpha) (MaxLight 405)

Sign In for Pricing
View Details
KLF10 (Kruppel-like Factor 10, EGRA, TIEG, TIEG1, EGR-alpha) (MaxLight 405)
MBS6447454-02 5x 0.1 mL

KLF10 (Kruppel-like Factor 10, EGRA, TIEG, TIEG1, EGR-alpha) (MaxLight 405)

Sign In for Pricing
View Details
Rat Heavy Chain Immunoglobulin ELISA Kit
MBS730526-01 48 Well

Rat Heavy Chain Immunoglobulin ELISA Kit

Sign In for Pricing
View Details
Rat Heavy Chain Immunoglobulin ELISA Kit
MBS730526-02 96 Well

Rat Heavy Chain Immunoglobulin ELISA Kit

Sign In for Pricing
View Details