Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS17 Peptide - middle region

RPS17 Peptide - middle region

Product Specifications

Product Name Alternative

DBA4, MGC72007, RPS17L1, RPS17L2

UniProt

P0CW22

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS17 Rabbit Polyclonal Antibody (orb585971) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012

Preservative

Lyophilized powder

AA Sequence

PVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Breast
CR561952 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Tissue FFPE Sections, Pleura
CS803228 5x 5 µm

Tissue FFPE Sections, Pleura

Sign In for Pricing
View Details
Human Bridging Integrator 2 (BIN2) ELISA Kit
RDR-BIN2-Hu-01 96 Tests

Human Bridging Integrator 2 (BIN2) ELISA Kit

Sign In for Pricing
View Details
Human Bridging Integrator 2 (BIN2) ELISA Kit
RDR-BIN2-Hu-02 48 Tests

Human Bridging Integrator 2 (BIN2) ELISA Kit

Sign In for Pricing
View Details
ETFBKMT (NM_001135863) Human Over-expression Lysate
LY427724 100 µg

ETFBKMT (NM_001135863) Human Over-expression Lysate

Sign In for Pricing
View Details
Nucleobindin 2 (NUCB2) Human Gene Knockout Kit (CRISPR)
KN420684 1 Kit

Nucleobindin 2 (NUCB2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details