RPS17 Peptide - middle region
RPS17 Peptide - middle region
Product Specifications
Product Name Alternative
DBA4, MGC72007, RPS17L1, RPS17L2
UniProt
P0CW22
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RPS17 Rabbit Polyclonal Antibody (orb585971) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001012
Preservative
Lyophilized powder
AA Sequence
PVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GAF-611-15 1 mL
Colloidal Gold Conjugated Sheep Purified Antibody to Mouse IgG, 15nm
Sign In for Pricing
View Details 
F-2402-2 2 mg
FITC Conjugated Griffonia simplicifolia Lectin -GS-II-
Sign In for Pricing
View Details 
TRC-B194114-5MG 5 mg
(2S)-1-(Benzyloxycarbonyl)azetidine-2-carboxylic acid-d5
Sign In for Pricing
View Details 
