Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS17 Peptide - C-terminal region

RPS17 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DBA4, MGC72007, RPS17L1, RPS17L2

UniProt

P0CW22

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS17 Rabbit Polyclonal Antibody (orb585972) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012

Preservative

Lyophilized powder

AA Sequence

SIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,6-Diamino-5-ethyl-5-phenyl-4(5H)-Pyrimidinone
TRC-D416435-5MG 5 mg

2,6-Diamino-5-ethyl-5-phenyl-4(5H)-Pyrimidinone

Sign In for Pricing
View Details
Glypican 5 (GPC5) (NM_004466) Human Over-expression Lysate
LY401421 100 µg

Glypican 5 (GPC5) (NM_004466) Human Over-expression Lysate

Sign In for Pricing
View Details
Human AFAF (EQTN) activation kit by CRISPRa
GA110192 1 Kit

Human AFAF (EQTN) activation kit by CRISPRa

Sign In for Pricing
View Details
CYBA Mouse Monoclonal Antibody [Clone ID: 7D5]
AM26496RP-N 50 Tests

CYBA Mouse Monoclonal Antibody [Clone ID: 7D5]

Sign In for Pricing
View Details
Cytokeratin 7 (OV-TL12/30), CF405S conjugate, 0.1mg/mL
BNC040683-500 1x 500 µL

Cytokeratin 7 (OV-TL12/30), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Cervix
CS636266 5x 5 µm

Frozen Tissue Sections, Cervix

Sign In for Pricing
View Details