Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS17 Peptide - C-terminal region

RPS17 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DBA4, MGC72007, RPS17L1, RPS17L2

UniProt

P0CW22

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS17 Rabbit Polyclonal Antibody (orb585972) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012

Preservative

Lyophilized powder

AA Sequence

SIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actr1b Mouse Gene Knockout Kit (CRISPR)
KN500790 1 Kit

Actr1b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human WDR51B (POC1B) activation kit by CRISPRa
GA116969 1 Kit

Human WDR51B (POC1B) activation kit by CRISPRa

Sign In for Pricing
View Details
Nos2 (NM_010927) Mouse Recombinant Protein
TP511704 20 µg

Nos2 (NM_010927) Mouse Recombinant Protein

Sign In for Pricing
View Details
TUBA3D (NM_080386) Human Over-expression Lysate
LC403306 20 µg

TUBA3D (NM_080386) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS628587 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
CD30 (TNFRSF8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI16H5]
TA801685AM 100 µL

CD30 (TNFRSF8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI16H5]

Sign In for Pricing
View Details