Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMA3E Peptide - C-terminal region

SEMA3E Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0331, M-SEMAH, M-SemaK, SEMAH, coll-5

UniProt

O15041

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEMA3E Rabbit Polyclonal Antibody (orb331281) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036563

Preservative

Lyophilized powder

AA Sequence

IENNSTLLECTPRSLQAKVIWFVQKGRETRKEEVKTDDRVVKMDLGLLFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXB2 Human Gene Knockout Kit (CRISPR)
KN416658 1 Kit

FOXB2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DHRS7B Human Gene Knockout Kit (CRISPR)
KN402625 1 Kit

DHRS7B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P Glycoprotein (ABCB1) Mouse Monoclonal Antibody [Clone ID: OTI1B8]
CF814176 100 µg

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody [Clone ID: OTI1B8]

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) Human Gene Knockout Kit (CRISPR)
KN202082RB 1 Kit

alpha 1 Antitrypsin (SERPINA1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD74 (CLIP/1133), CF594 conjugate, 0.1mg/mL
BNC941133-100 1x 100 µL

CD74 (CLIP/1133), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Semenogelin II (SEMG2) Rabbit Polyclonal Antibody
TA381353 100 µL

Semenogelin II (SEMG2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details